Protein Info for OH686_04725 in Pseudomonas sp. S08-1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details PF00892: EamA" amino acids 8 to 140 (133 residues), 86.2 bits, see alignment E=2.3e-28 amino acids 154 to 286 (133 residues), 93.4 bits, see alignment E=1.4e-30

Best Hits

KEGG orthology group: None (inferred from 75% identity to pap:PSPA7_4318)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>OH686_04725 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas sp. S08-1)
MAPQGRLFAMACLVLAMALWGSSFIALKFAFAELPPMWVIFGRMALGSLVFLLAWRWRGR
LDYRPGDWRYLLALAACEPCLYFIFEALALQHTSATQAGMITALLPLLVAMGAFLFLHER
VARSTWAGFLLAVIGAIWLSVASEADSHAPAPLLGNFYEFVAMLCATCYTLLLKFLSERY
SPFILTAMQAFIGSLFFLPLALVTEPLPSQFGLLGIGSVIYLGVVVTVGAYGLYNFGVSR
LPASQASGFTNLLPVFTLIFAALLLGESLTPAQYAAAALVFVGVALSQWRSAAPAPVGIL
D