Protein Info for OH686_04425 in Pseudomonas sp. S08-1

Annotation: Colicin V production protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details PF02674: Colicin_V" amino acids 6 to 145 (140 residues), 129.1 bits, see alignment E=6.6e-42

Best Hits

KEGG orthology group: K03558, membrane protein required for colicin V production (inferred from 83% identity to pfv:Psefu_3064)

Predicted SEED Role

"Colicin V production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>OH686_04425 Colicin V production protein (Pseudomonas sp. S08-1)
MAFTWVDWAIIAVIAISSLISLRRGFFKEALSLLTWIIAGVVAWMFGGALSQHLTDFIET
PSMRVIAACAILFIVTLLVGALINFLIGELIRVTGLSGTDRFLGMVFGAARGALLVVVLV
GLVSLAPVQQDEWWQQSTLMPHFLMVADWSKNLILSLTSQWLASGITQTPELPSYEGLLQ
PKLP