Protein Info for OH686_04415 in Pseudomonas sp. S08-1

Annotation: O-succinylhomoserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01325: O-succinylhomoserine sulfhydrylase
  • amino acids 20 to 400 (381 residues), 640.6 bits, E=3.3e-197
• PF01053: Cys_Met_Meta_PP
  • amino acids 20 to 400 (381 residues), 468.2 bits, E=3.1e-144
• PF00155: Aminotran_1_2
  • amino acids 42 to 197 (156 residues), 46.9 bits, E=4.7e-16
• PF01041: DegT_DnrJ_EryC1
  • amino acids 72 to 196 (125 residues), 26.6 bits, E=7.3e-10
• PF00266: Aminotran_5
  • amino acids 75 to 236 (162 residues), 35.9 bits, E=8.8e-13

Best Hits

Swiss-Prot: 86% identical to METZ_PSEAE: O-succinylhomoserine sulfhydrylase (metZ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 88% identity to pmk:MDS_2008)

MetaCyc: 86% identical to O-succinyl-L-homoserine sulfhydrylase (Pseudomonas aeruginosa PAO1)
Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• L-methionine biosynthesis I (3/5 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• homocysteine and cysteine interconversion (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Cysteine metabolism
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Selenoamino acid metabolism
• Sulfur metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49

Protein Sequence (403 amino acids)

>OH686_04415 O-succinylhomoserine sulfhydrylase (Pseudomonas sp. S08-1)
MSQDWEAGRLDSDLEGVGFDTLAVRAGQHRTPEGEHGEAMFLTSSYVFRSAADAAARFAG
EVPGNVYSRYTNPTVRAFEERIAALEGAEQAVATASGMAAILAIVMSQCGAGDHVLVSRS
VFGSTISLFEKYLKRFGIEVDYPSLADLAAWEAGFKPNTKLLFVESPSNPLAELVDIAAL
AEIAHARKALLVVDNCFCTPALQQPLKLGADIIMHSATKYIDGQGRGLGGVVAGRKAEME
AVVGFLRTAGPTLSPFNAWMFLKGLETLRVRMQAHSASALQLAQWLETQPGIDKVYYSGL
PSHPQHELAKRQQSAFGAVVSFEVAGGKEAAWRFIDATRVISITTNLGDTKTTIAHPATT
SHGRLSPQERANAGIRDNLIRVAVGLEDLADLKADLARGLAAL