Protein Info for OH686_04355 in Pseudomonas sp. S08-1

Annotation: type II secretion system protein L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 229 to 253 (25 residues), see Phobius details TIGR01709: type II secretion system protein L" amino acids 6 to 378 (373 residues), 247.1 bits, see alignment E=1.6e-77 PF05134: T2SSL" amino acids 43 to 219 (177 residues), 109.6 bits, see alignment E=1.6e-35 PF12693: GspL_C" amino acids 225 to 378 (154 residues), 136.2 bits, see alignment E=9.3e-44

Best Hits

Swiss-Prot: 58% identical to GSPL_PSEAE: Type II secretion system protein L (xcpY) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 61% identity to pmy:Pmen_2918)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>OH686_04355 type II secretion system protein L (Pseudomonas sp. S08-1)
MSLLSVFLPPQACAETAADLPVWRVDGDICSQRPFAEALPREDQAWRLVLPVEAVTVCAV
QLPTTKARWLQKALPFAVEELLAEDVEQFHLSVGGQLADGRHRVYAVRRAWLSGWLALCG
DNPPQRIEVDADLLVEEGSQLLCLGERWLLGGTGEARLALRSEDWPQLAGLCPSPRVAYV
ANGQAAPADVDEAHEVAQLLPWLAQQRAQCNLAQGPFARREPSGQWQRWRPLAALVGLCL
LLQWGFNLAQGWYLQREGERYAQASQELYRELFPDDNKLINLRAQFDQHLAEAAGGGQSQ
LLSLLDQAAAAINQEGAKVQVQQLDFNAQRGDLALNLQANDFASLESLRTRLQEAGLAVD
MGSASREDSGVSARLVIGGNG