Protein Info for OH686_04240 in Pseudomonas sp. S08-1

Annotation: Exporter protein, RND family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 795 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 371 to 396 (26 residues), see Phobius details amino acids 421 to 444 (24 residues), see Phobius details amino acids 627 to 645 (19 residues), see Phobius details amino acids 652 to 673 (22 residues), see Phobius details amino acids 679 to 700 (22 residues), see Phobius details amino acids 726 to 746 (21 residues), see Phobius details amino acids 754 to 779 (26 residues), see Phobius details PF03176: MMPL" amino acids 480 to 777 (298 residues), 95.1 bits, see alignment E=2.1e-31

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 84% identity to ppu:PP_2019)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (795 amino acids)

>OH686_04240 Exporter protein, RND family (Pseudomonas sp. S08-1)
MSSMSSHHQDKATFLERLIFNNRPIVIALCTVITMLLLWQASHIRPSTSFEKMIPLEHPF
IEKMLEHRNDLANLGNTVRISVEAKDGDIFSKEYMETLRQIHDEVFYIPGVDRSGLKSLW
SPSVRWTEVTEEGFDGGEVIPQTYDGSAQSLGELRSNVLKSGQVGRLVANNFKSSIIDVP
LLEQYPDPKDQSKLLKLDYRQFSHELEEKIRDKYQAQNPNVQVHIVGFAKKVGDLIDGLI
MVVAFFGIALVITLVLLYWFSWCIRSTISVVSTTLIAVVWQLGLMNLAGFGLDPYSMLVP
FLIFAIGISHGVQKINGIALQSSDADNALTAARRTFRQLFLPGMIAILVDAVGFITLLII
DIGVIRELAIGASIGVGVIVFTNLILLPVAISYIGISKKAVERSKREANCDQPFWRLLSN
FAHPVVAPISVVIALSAGVASFWYQKAHLQIGDLDQGAPELRPDSRYNKDNDFIISNYST
SSDVLVVMVKTPNEGCSTHQTLAPIDQLMWQLENTEGVQSAISMVSVSKQVIKGMNEGSL
KWETLSRNPDILNNSIARADGLYNADCSLAPVLVFLNDHKAATLKRAVGVVEEFAKENNK
DDLQFLLAAGNAGIEAATNEVIATSELKILVLVYICVAVMCLITFRSFGAMLCIILPLIL
TSILGNALMAWLGIGVKVATLPVIALGVGIGVDYGIYIYSRLESFLRAGMPLQEAYYQTL
RSTGKAVLFTGLCLAIGVVTWIFSAIKFQADMGLMLTFMLLWNMFGALWLLPALARFLIK
PEKLAGKKGGSLFAH