Protein Info for OH686_03995 in Pseudomonas sp. S08-1
Annotation: Aromatic-L-amino-acid decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 84% identity to pmk:MDS_2124)Predicted SEED Role
"Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28)" in subsystem Aromatic amino acid degradation or Auxin biosynthesis (EC 4.1.1.28)
MetaCyc Pathways
- betaxanthin biosynthesis (via dopamine) (2/2 steps found)
- betaxanthin biosynthesis (2/3 steps found)
- L-dopa degradation II (bacterial) (1/2 steps found)
- octopamine biosynthesis (1/2 steps found)
- L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
- salidroside biosynthesis (2/4 steps found)
- L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
- phenylethanol biosynthesis (2/5 steps found)
- catecholamine biosynthesis (1/4 steps found)
- serotonin and melatonin biosynthesis (1/4 steps found)
- hydroxycinnamic acid tyramine amides biosynthesis (1/5 steps found)
- beta-carboline biosynthesis (1/6 steps found)
- hydroxycinnamic acid serotonin amides biosynthesis (1/6 steps found)
- psilocybin biosynthesis (1/6 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
- (S)-reticuline biosynthesis II (1/7 steps found)
- indole-3-acetate biosynthesis II (4/12 steps found)
- methanofuran biosynthesis (1/8 steps found)
- (S)-reticuline biosynthesis I (3/11 steps found)
- superpathway of betalain biosynthesis (13/27 steps found)
- secologanin and strictosidine biosynthesis (2/17 steps found)
- Amaryllidacea alkaloids biosynthesis (1/26 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Biosynthesis of alkaloids derived from shikimate pathway
- Histidine metabolism
- Indole and ipecac alkaloid biosynthesis
- Phenylalanine metabolism
- Tryptophan metabolism
- Tyrosine metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (448 amino acids)
>OH686_03995 Aromatic-L-amino-acid decarboxylase (Pseudomonas sp. S08-1) MNERQLLAEADRRALAYFDGSAQRRVFPDDQAIAALSTFDQPLPESGQDAQRVLQQLDEL GSPATVTSNGPRYFGFVIGATLPAAAAAERMVLAWDQCASSFDNSPIADRLEKVAGRWVC QALGLPSESAVGFGTSATACTLACLSAARRKLLARQGWNFDADGLMGAPEIRVVLSETAH ITVKKALRVLGFGMNRLHYAPVDEHGRIDPTRLPALDERTLLILQAGEVNTGEFDRFAEL IPKAREAGAWVHVDGAFGLWARASSSAHLAEGVEQADSWTTDGHKWLNTPYDSAMAICRD ADALAAAMNSDAAYATASRDAQKNLTLEFSRRARGVAIWAALASLGREGLRELIDRHIRQ AGELAETLRGGGYQVLNRVVLNQVLVRGDSDAQTTAIREAAQASGEVWFGPTVWQGRPAF RLSLSSWRTEDRHVHALAELLLRLKRQL