Protein Info for OH686_03825 in Pseudomonas sp. S08-1

Annotation: NAD synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00552: NAD+ synthetase" amino acids 26 to 272 (247 residues), 225.9 bits, see alignment E=2.3e-71 PF02540: NAD_synthase" amino acids 28 to 272 (245 residues), 214 bits, see alignment E=9e-68

Best Hits

Swiss-Prot: 90% identical to NADE_PSEMY: NH(3)-dependent NAD(+) synthetase (nadE) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 90% identity to pmy:Pmen_1410)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>OH686_03825 NAD synthetase  (Pseudomonas sp. S08-1)
MSNRQAEIAAALDVVPPFADEAALVAEIERRKNFIKNTLRNSGLKVLVLGISGGVDSTTA
GRLAQLSVEELRAETGDAGYRFIAVRLPHKTQHDEHDAQDSLKFVGADINDTVNIAPSVL
GLGEQVADLQKLSEPRRDFVNGNIKARIRMVAQFAIANANNGLVIGTDHAAEAVMGFFTK
FGDGACDLAPLSGLVKGQVRAIAAYLGAPQHLVQKTPTADLEELRPGKPDEEAHGVSYAE
IDAFLHGEKVSDEAYATIVRTYDNTRHKRELPLVP