Protein Info for OH686_03785 in Pseudomonas sp. S08-1

Annotation: Methyl-accepting chemotaxis sensor/transducer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF05227: CHASE3" amino acids 38 to 173 (136 residues), 158.1 bits, see alignment E=1.9e-50 PF00672: HAMP" amino acids 203 to 256 (54 residues), 40.8 bits, see alignment 3.5e-14 amino acids 249 to 283 (35 residues), 16.3 bits, see alignment (E = 1.5e-06) amino acids 327 to 372 (46 residues), 18.4 bits, see alignment 3.4e-07 PF00015: MCPsignal" amino acids 436 to 617 (182 residues), 120.9 bits, see alignment E=8.1e-39

Best Hits

Predicted SEED Role

"type IV pilus biogenesis protein PilJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (653 amino acids)

>OH686_03785 Methyl-accepting chemotaxis sensor/transducer protein (Pseudomonas sp. S08-1)
MRFSIGAKLWVSFCAILLVIVVIGGISYRNTLNMLETSRWVAHTHQVVAQLSAVLATVQS
AETGQRGFIITGAERYLDPYNAALLKLDGDLRSLRELTADNPEQQRRLGRLEPLIATKLA
ELKETIELRRAQGFEPALQLVLTDKGKQAMVEIRSLVGEMVAEEEQLQAARDAAASASAD
TSQWVIVLGMTLSALLVVAAALFLTQNIVGPLRAVSAVADRVSVGNLGVELAASTRSDEI
GALQAAILRMLQSLRQTAESARQIAAGNLAIEVQPQSRDDQFGHAFADMLQALRHVAESA
RQIAAGNLAVEVQPQSASDQFGQAFARMHQSLRQMAESARQIAAGNLTIEVQPQSANDLL
GNAFAQMLADLRQINGDIRGGIGVLTDSASEIAAGAYQIASGTAETATAISETSATMEEI
KQTALLSSQRALSVSQAAQRSMQVSQDGRRAVDEVVEGMRRIHQQMEQVGENITHLAEQV
QTIGEIIATVNDLAEQSNLLAVNASIEAAKAGEQGKGFSVVAQEVKSLAEQSKQATVQVR
GILGEIQRATSSTVLAAEQGSRAVSEGVKQSGQAGEAIRLLSLNIDEGAQAVAEIAVSAQ
QQLAGMDQLVLAMESIREASSQNMSSSKQAEAAAQGLHQLGQKMKGVLARFQI