Protein Info for OH686_03720 in Pseudomonas sp. S08-1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details PF00892: EamA" amino acids 8 to 139 (132 residues), 47.8 bits, see alignment E=8.5e-17 amino acids 154 to 280 (127 residues), 66.2 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: None (inferred from 82% identity to pmy:Pmen_2040)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>OH686_03720 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas sp. S08-1)
MDKTLKRGSLEMIAAMLISGTIGWFVLISGQSVIDVVFWRCVIGGAMLLLVCGALGLLRR
ELLSRRVLLLALVSGVAIVGNWLLLFASYSKASIAISTAVYNVQPFMLVGLAALFLGERI
TLAKLAWLGVAFLGMLAIVSAHGDTGTSGENYLLGIALALGAALLYAVAALIVKRLSGTP
PHLIALVQLLTGILMLAPLASYQLPEQPQAWASLAALGILHTGVMYMLLYSAIQKLPTAL
TGALSFVYPIAAIFVDWLAFGHRLSPLQWLGVAAILLAAAGMQQGWSLRRRRLAAA