Protein Info for OH686_03710 in Pseudomonas sp. S08-1

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 203 to 363 (161 residues), 155.5 bits, see alignment E=5.3e-50 PF00990: GGDEF" amino acids 205 to 361 (157 residues), 171.7 bits, see alignment E=1.1e-54 PF00563: EAL" amino acids 383 to 613 (231 residues), 249.3 bits, see alignment E=3.6e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>OH686_03710 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Pseudomonas sp. S08-1)
MTRAQPSRQPDAGSDPLERRLQAQRLVQIANVLCVVLLLIGAQTVVAGSWLNTGLVTAAL
LLVVVGRWLNRRGRVELSVALVLCSLTVLVGTSLWFSQGLYSAAVLGFPAILIVAGMVAS
LRLFIGLLLGILAMVAFLTYAALSGLQSFEPLPLGIGRMVNVSCILLTCAAAVWLLANDL
RKALLRLQQEILRVKDSEASFTHLAQHDALTNLPNRLLIRDRMEQAIGRARRDDEQVALL
FLDLDNFKTINDSLGHAAGDELLQEVARRLKDTVRDIDTVSRQGGDEFLMVLADVADLAA
VSSVAALVQQKLAQPFALKGMQIVTSISIGISLFPGDGDDFDTLLKHADMAMYQAKSAGR
NGFCFFDEQMNADTHERLALELDLRQALSRGEFVLHYQPIIDLHGGRLLAAEALLRWQHP
QRGTLGPDRFIRVAEESGLIVEIGEWVLNEACRQAMLWQAAGLPRFAVAVNLSAVQFRRG
NLEAMVHAALNRFGLAPACLELELTESILLQDSAQLRRLKELGVKLSIDDFGTGYSSLSY
LQRFQVDKLKIDQSFVRGLTGNAQDQAIVTAIVQMARSLGLHTTAEGIEDEATRALLAEL
GCDQGQGFLFARPLAATEFGAFARRQQVAV