Protein Info for OH686_02990 in Pseudomonas sp. S08-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 41 to 113 (73 residues), 72.6 bits, see alignment E=4e-24 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 104 to 239 (136 residues), 136.2 bits, see alignment E=3.6e-44 PF08666: SAF" amino acids 116 to 175 (60 residues), 44.9 bits, see alignment E=2e-15 PF13144: ChapFlgA" amino acids 117 to 239 (123 residues), 122.7 bits, see alignment E=1.4e-39

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 61% identity to pfv:Psefu_3109)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>OH686_02990 hypothetical protein (Pseudomonas sp. S08-1)
MAKRLFLAGVVPALGLFGYSSLHAAPLTLPEELIGATEGFLEFTVEDYLERSEIPARHDI
QVNSIDPRLRLAACDSDLTQSLESPAQPVGRVTVRVSCEGTTPWTVFIPAQVRIFRPVAV
LKNPLKRDSIIGPEDIAMIEQDIGLLNRGYISDPEQAIGKKLTRPLQADQVLTPAILQLA
ESVRRGDQVVIAARAGGINVRVQGEALSGGTLGQQISVRNLSSQRVVRARVIGPGQVEVG
M