Protein Info for OH686_02965 in Pseudomonas sp. S08-1

Annotation: Flagellar basal-body rod modification protein FlgD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF03963: FlgD" amino acids 16 to 74 (59 residues), 80.3 bits, see alignment E=1.5e-26 PF13861: FLgD_tudor" amino acids 82 to 218 (137 residues), 56.9 bits, see alignment E=3e-19 PF13860: FlgD_ig" amino acids 107 to 176 (70 residues), 78 bits, see alignment E=6.9e-26

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 81% identity to pmk:MDS_1819)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>OH686_02965 Flagellar basal-body rod modification protein FlgD (Pseudomonas sp. S08-1)
MSVSGVSSVLDQYQIKQETGQSKELGKNEFLELLVAQLNNQNPLEPQENGEFIAQLAQFS
QVEGIEQLNTRMESLLSGYQSSQALQASSLVGRKVIVPSEKAVVDTSETFKGSLVLPVTS
SNVYVNIYDNAGKVVNRVNLGQQAAGNVSFMWDGKDSSGNLMPPGTYKFEAQATYADGTK
GLYTLLPANVDSVALGQNGGEMKLNLAGIGAVPLSQVQIIGQ