Protein Info for OH686_02870 in Pseudomonas sp. S08-1

Annotation: flagellar protein FliS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 TIGR00208: flagellar protein FliS" amino acids 1 to 120 (120 residues), 68.1 bits, see alignment E=3.8e-23 PF02561: FliS" amino acids 8 to 121 (114 residues), 100.9 bits, see alignment E=2.7e-33

Best Hits

Swiss-Prot: 67% identical to FLISA_PSEAI: Flagellar secretion chaperone FliSA (fliS) from Pseudomonas aeruginosa

KEGG orthology group: K02422, flagellar protein FliS (inferred from 84% identity to pmy:Pmen_2832)

Predicted SEED Role

"Flagellar biosynthesis protein FliS" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>OH686_02870 flagellar protein FliS (Pseudomonas sp. S08-1)
MMSKKPIDTYKKVKTSQEVSPYRAVQMLLDGALERVLLARQAQAEGDIEIRGMAVGSTIT
ILGVLQSSLDKKLGGEIAENLDALYDYMTRRLAGVALDDTPRSLDEVQALLTQIKTAWDS
IGPEVEPAAAAE