Protein Info for OH686_02805 in Pseudomonas sp. S08-1

Annotation: Serine phosphatase RsbU, regulator of sigma subunit / Serine-protein kinase RsbW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 243 to 259 (17 residues), see Phobius details PF00072: Response_reg" amino acids 7 to 117 (111 residues), 73 bits, see alignment E=3.3e-24 PF07228: SpoIIE" amino acids 191 to 377 (187 residues), 145.3 bits, see alignment E=3.3e-46 PF13581: HATPase_c_2" amino acids 444 to 560 (117 residues), 32.9 bits, see alignment E=8.9e-12

Best Hits

KEGG orthology group: None (inferred from 75% identity to avn:Avin_34360)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>OH686_02805 Serine phosphatase RsbU, regulator of sigma subunit / Serine-protein kinase RsbW  (Pseudomonas sp. S08-1)
MPNRLSILIAEDSAADRMLLSTIVSRQGHRVLTASNGLEAVGLFEQERPHLVLMDALMPV
MDGFEAARRIKGLAGEALVPIIFLTSLTESEALVRCLEVGDDFLAKPYNQVILQAKISAM
DRLRRLQKTVLEQRDLIAKHNEHLLTEQRVAKAVFDKVAHSGCLSAANIRYLQSPFALFN
GDLLLAAFKPSGGMHVLLGDFTGHGLPAAIGAMPLSEVFYGMTAKGFSMAEILREMNAKL
KRILPVGVFCCATMLNLSFQRRVVEVWNGGLPDGHLLRVSSGERVPLVSRHLPLGVLDPA
SFNEAYEVHPLQPGDRIFLLSDGVLETRDASEQLFGEERLLQVFASGHAPERLFDEIQRA
LTAFRGEAQDDVSMIELSMVDDSVLSRPPLAFSDSGQSSPLDWSASFEFRAEALKRFNPL
PFLLQLLMEVRGLRAQGGALYTVMAELYSNALEHGVLGLDSKLKSDAQGFAQYYRERSQR
LLTLQEGFVRFDLELLPEAGGGCLRIHVQDSGAGFDVSRALDRQRDCDSLSGRGLRLICQ
LADQCQWSPDGRGAIVEFRWAAQA