Protein Info for OH686_02480 in Pseudomonas sp. S08-1

Annotation: DNA-binding response regulator GltR, controls specific porins for the entry of glucose

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00072: Response_reg" amino acids 8 to 120 (113 residues), 104.8 bits, see alignment E=2.9e-34

Best Hits

Swiss-Prot: 34% identical to ARCA_HAEIN: Aerobic respiration control protein ArcA homolog (arcA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_4373)

Predicted SEED Role

"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>OH686_02480 DNA-binding response regulator GltR, controls specific porins for the entry of glucose (Pseudomonas sp. S08-1)
MSQAGKSILLVDDDEEIRDLLQVYLSRAGFQVRAVADGAAFRQALGEAITDLVILDVMLP
DEDGFSLCRWMRQHQRFAQVPIIMLTASSDEADRVIGLELGADDYLGKPFSPRELQARIK
ALLRRAGFGQERGTAEVLAFDEWRLDMVSHRLFHLDGEEVILSGADFALLKLFLDHPQQI
LDRDTIANATRGREVMPLERIVDMAVSRLRQRLRDTGKAPRLIRTVRGSGYLLAASVTAH
AGAAL