Protein Info for OH686_02385 in Pseudomonas sp. S08-1

Annotation: recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR00615: recombination protein RecR" amino acids 2 to 195 (194 residues), 236.3 bits, see alignment E=1e-74 PF21176: RecR_HhH" amino acids 7 to 51 (45 residues), 72.5 bits, see alignment 5e-24 PF02132: RecR_ZnF" amino acids 54 to 74 (21 residues), 32.2 bits, see alignment (E = 1.7e-11) PF13662: Toprim_4" amino acids 82 to 170 (89 residues), 89.3 bits, see alignment E=3.9e-29 PF01751: Toprim" amino acids 82 to 161 (80 residues), 48.3 bits, see alignment E=2.4e-16 PF21175: RecR_C" amino acids 172 to 195 (24 residues), 51.3 bits, see alignment (E = 1.7e-17)

Best Hits

Swiss-Prot: 87% identical to RECR_PSEAB: Recombination protein RecR (recR) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K06187, recombination protein RecR (inferred from 87% identity to pau:PA14_44610)

MetaCyc: 61% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>OH686_02385 recombination protein RecR (Pseudomonas sp. S08-1)
MSFSPLIRQLIDSLRLLPGVGQKTAQRMALQLLERDRSGGMRLSQALAAAMEGVGHCKRC
RTLSEDELCPQCSDPRRDDALLCVVEGPLDVFAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPELLAHIGASQYGEVILATNPTVEGEATAHYIAQMLGNKGIVLSRIAHGVPLGGELE
LVDGGTLAHALAGRRPISG