Protein Info for OH686_02030 in Pseudomonas sp. S08-1

Annotation: Threonine/homoserine exporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details PF00892: EamA" amino acids 144 to 272 (129 residues), 67.7 bits, see alignment E=5.9e-23

Best Hits

Swiss-Prot: 63% identical to RHTA_ECOL6: Threonine/homoserine exporter RhtA (rhtA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 80% identity to pmy:Pmen_2514)

MetaCyc: 63% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>OH686_02030 Threonine/homoserine exporter RhtA (Pseudomonas sp. S08-1)
MPRSTLLLPIALLVVAMTSIQSGASLAKSLFPLIGPEGTTALRLSLAALILCIVMRPWRT
RPNFAAWRSLLGYGLSLGAMNLLFYMSLKSIPLGIAVALEFTGPLALALFSSRRLLDFVW
IALAVLGLWLLLPDTSAADHLDLLGMALALGAGVCWALYILFGQRAGAAHGAQTVAFGTM
VAALLVFPVGLWQVGGGLFSLDLLPVALAVAVMSSALPYSLEMFALTRMPARTFSVLMSL
EPAIAALSGLIFLSENLSPVQWLAIGAIILASTGAAATIKPRAHA