Protein Info for OH686_01720 in Pseudomonas sp. S08-1

Annotation: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02137: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein
  • amino acids 1 to 203 (203 residues), 401 bits, E=4.1e-125
• PF00702: Hydrolase
  • amino acids 48 to 163 (116 residues), 41.5 bits, E=2e-14
• PF12710: HAD
  • amino acids 62 to 160 (99 residues), 35.7 bits, E=1.2e-12

Best Hits

Swiss-Prot: 96% identical to THRH_PSEAE: Phosphoserine phosphatase ThrH (thrH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02203, phosphoserine / homoserine phosphotransferase [EC: 2.7.1.39 3.1.3.3] (inferred from 93% identity to pmy:Pmen_2544)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39, 3.1.3.3

Use Curated BLAST to search for 2.7.1.39 or 3.1.3.3

Protein Sequence (205 amino acids)

>OH686_01720 phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein (Pseudomonas sp. S08-1)
MEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLRDI
QEVIATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPALLCHKLITDETD
RVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHAPDNVIREFP
QFPAVHTYEDLKREFLKASNRELSL