Protein Info for OH686_00920 in Pseudomonas sp. S08-1

Annotation: Multidrug efflux system MdtABC-TolC, membrane fusion component MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 51 to 379 (329 residues), 236.6 bits, see alignment E=1.7e-74 PF16576: HlyD_D23" amino acids 65 to 298 (234 residues), 38.1 bits, see alignment E=1.5e-13 PF13533: Biotin_lipoyl_2" amino acids 76 to 124 (49 residues), 58.1 bits, see alignment 8.8e-20

Best Hits

Swiss-Prot: 54% identical to MDTA_KLEP7: Multidrug resistance protein MdtA (mdtA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 72% identity to pmy:Pmen_2431)

MetaCyc: 50% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>OH686_00920 Multidrug efflux system MdtABC-TolC, membrane fusion component MdtA (Pseudomonas sp. S08-1)
MPESRRFPRLSRPWLIALTVLLGAVLVWWLLPGKPEQKTEGNSPWEGPVPVRLTEVGSGD
FHIELKALGTVTALNTVNVRSRVDGELVKVFFEEGQLVKAGDLLAQIDPRPYQVALQQAE
GTLAQNQAQLKNAEIDLARYQGLYAEDSIAKQTLDTQQALVGQYRGTVKSNQAAVADARL
NLDFTRIRAPISGRLGLRQVDLGNLVRSSDTTPLVVITQVEPIAVNFTLPEKDLPPVLAK
VRANQKLLVQAWDRGEQQLLAEGELHSLDNQIDVATGTVKLKGRFSNAGELLFPNQFVNV
RLRVETRQQATLIPSAAVQFGARGTFVFVLGVDDKVQLRDIKVAASDGATSLIDSGVKVG
ERLVLEGTDKLKEGSQVQVIGNEPGALAQPQGQASQKQGA