Protein Info for OH686_00340 in Pseudomonas sp. S08-1

Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 TIGR00194: excinuclease ABC subunit C" amino acids 1 to 563 (563 residues), 600.9 bits, see alignment E=1.4e-184 PF01541: GIY-YIG" amino acids 2 to 71 (70 residues), 30.7 bits, see alignment E=9.7e-11 PF02151: UVR" amino acids 184 to 215 (32 residues), 29.4 bits, see alignment (E = 1.5e-10) PF08459: UvrC_RNaseH_dom" amino acids 361 to 516 (156 residues), 183.9 bits, see alignment E=5.9e-58 PF14520: HHH_5" amino acids 531 to 582 (52 residues), 44.1 bits, see alignment 7.1e-15 PF00633: HHH" amino acids 553 to 580 (28 residues), 24.1 bits, see alignment (E = 7.1e-09)

Best Hits

Swiss-Prot: 88% identical to UVRC_PSEPH: UvrABC system protein C (uvrC) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 86% identity to pmk:MDS_2396)

MetaCyc: 53% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>OH686_00340 excinuclease ABC subunit C (Pseudomonas sp. S08-1)
MFDDTGKLLYVGKASNLKKRLASYFRKTGLAPKTAALVARIAQVETTIVANETEALLLEQ
TLIKQWRPPYNILLRDDKSYPYVLLSDGDYPRLGIHRGAKSAKGRYFGPYPSAGAIRESL
ALLQKTFLVRQCEDSYFKNRTRPCLQYQIKRCKGPCVGLVDPQEYAEDVRHSVMFLEGRS
SALTDELSAAMEKAAMGLEFELAAELRDQISQLRRVQDQQSMEGGSGDVDVVAAIVNPGG
ACVHLISVRGGRVLGSKNFFPQVGIEEEGGAVMSAFLAQYYLSSHERDLPGELIVNVDHE
DLPTVAAAIAESRGREIGISHRVRGTRARWQQLAVTNAEQALSARLANRQHVAARFEALA
DALDLDEPPQRLECYDISHSSGEATVASCVVFGPEGPLKSDYRRYNIEGVTAGDDYAAMH
QALTRRFSKLKDGEGKLPDILLVDGGKGQLAMAREVLQELAVPELILLGVAKGVTRKPGL
ETLYLNDADHEFTLPADSPALHLIQQIRDEAHRFAITGHRARRGKARRTSSLEDVAGIGP
KRRRELLKHFGGLQELNRASVEEIAKAPGISKKLAESIYAALHSE