Protein Info for OH686_00185 in Pseudomonas sp. S08-1

Annotation: GNAT family acetyltransferase YjcF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF13673: Acetyltransf_10" amino acids 25 to 137 (113 residues), 61.6 bits, see alignment E=1.2e-20 PF00583: Acetyltransf_1" amino acids 31 to 119 (89 residues), 51.2 bits, see alignment E=2.1e-17 PF13508: Acetyltransf_7" amino acids 47 to 121 (75 residues), 49.5 bits, see alignment E=7e-17

Best Hits

Swiss-Prot: 32% identical to YYAT_BACSU: Uncharacterized protein YyaT (yyaT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 76% identity to pau:PA14_30090)

Predicted SEED Role

"GNAT family acetyltransferase YjcF" in subsystem Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>OH686_00185 GNAT family acetyltransferase YjcF (Pseudomonas sp. S08-1)
MSEIHVRLAHWQKDNADLRRIREAVFVAEQAVPAELEWDDEDIEAVHFLACEGDYPIGTA
RLLADGQIGRVSVLKDWRGLKVGDALMRAAIEAAEARGQYEQKLSAQVHATAFYERLGFQ
VEGGEYLEAGIPHVLMVRHSD