Protein Info for NOLOHH_24410 in Escherichia coli ECOR27

Annotation: PapC/FimD family outer membrane usher protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 836 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13954: PapC_N" amino acids 31 to 182 (152 residues), 119.4 bits, see alignment E=1.9e-38 PF00577: Usher" amino acids 198 to 750 (553 residues), 517.2 bits, see alignment E=9.9e-159 PF13953: PapC_C" amino acids 761 to 818 (58 residues), 49.7 bits, see alignment 4e-17

Best Hits

Swiss-Prot: 72% identical to PAPC_ECOLX: Outer membrane usher protein PapC (papC) from Escherichia coli

KEGG orthology group: None (inferred from 95% identity to ecp:ECP_2970)

Predicted SEED Role

"Outer membrane usher protein PapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (836 amino acids)

>NOLOHH_24410 PapC/FimD family outer membrane usher protein (Escherichia coli ECOR27)
MKKNKSTFTINFITYSLMLSLAGVPVYAVDFNTDVLDAADRQNIDFSRFSRAGYIMPGQY
QMEIKVNDQSISPSAFQITFLDPPYSDSDNEKPLPEPCLTPEMVGHMGLTEASQEKITYW
NNGQCADFRQLSGVEIRPNPAEGMLYINMPQAWLEYSDASWLPPSRWDNGIPGLLFDYNI
NGTVNKPHQGKQSQSLNYNGTAGANFGAWRLRADYQGNLNHTTGSAQGTDSQFTWSRFYM
YRAIPRWRANLTLGENYINSEIFSSWRYTGASLESDDRMLPPKLRGYAPQVSGIADTNAR
VVISQQGRILYDATVPAGPFTIQDLDSSVRGRLDVEVIEQDGRKKTFQVDTAYVPYLTRP
GQVRYRLVSGRSRNYEHTTEGPVFAAGEASWGISNKWSLYGGGIVAGDYNALAVGLGRDL
NEFGTVSADVTQSVARIPGEETKQGKSWRLSYSKRFDDVNTDITFAGYRFSERNYMTMDQ
YLNARYRNDFTGREKELYTVTLNKNFEDWKTSVNLQYSHQTYWDRRTSDYYTLSVNRYFD
AFSFKNIALGLSASRSKYQNRDNDSAFVRLSVPWGTGTASYSGSMSNDRYTNTVGYSDTL
NKGLSSYSLNAGVSSGGSQPSQSQMSAYYNHSSPLASLSANFSAVENGYTSFGMSASGGA
TITAKGAALHAGGMNGGTRLLVDTDGVGGVPVDGGRVSTNRWGIGVVTDVSSYYRNITSV
DLNRLPEDMEATRSVVESVLTEGAIGYREFEVLKGSRLFAVLRLADNSHPPFGASVTNAK
GRELGMVADSGLAWLSGVNPGETLNVGWDGRTQCVVDIPAHPDPAQQLLLPCRQVK