Protein Info for NOLOHH_24130 in Escherichia coli ECOR27

Name: yhhI
Annotation: ISAs1 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 31 to 48 (18 residues), see Phobius details PF01609: DDE_Tnp_1" amino acids 9 to 250 (242 residues), 107.3 bits, see alignment E=4.6e-35

Best Hits

KEGG orthology group: None (inferred from 98% identity to ecr:ECIAI1_0250)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>NOLOHH_24130 ISAs1 family transposase (Escherichia coli ECOR27)
MRDCHSSNDKDVIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIRTDEKSNEIT
AIPELLNMLDIKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLK
ELNNPEHDSYAISEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQ
KKEPEMTVRYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELF
SGIRHIAINILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS