Protein Info for NOLOHH_24055 in Escherichia coli ECOR27

Name: ybdG
Annotation: mechanosensitive ion channel YbdG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 23 to 48 (26 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 193 (27 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 185 to 253 (69 residues), 63.1 bits, see alignment E=2.1e-21 PF21082: MS_channel_3rd" amino acids 328 to 396 (69 residues), 46.9 bits, see alignment E=3e-16

Best Hits

Swiss-Prot: 100% identical to YBDG_ECOLI: Miniconductance mechanosensitive channel YbdG (ybdG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0577)

Predicted SEED Role

"Uncharacterized protein ybdG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>NOLOHH_24055 mechanosensitive ion channel YbdG (Escherichia coli ECOR27)
MQDLISQVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVLRTFEKRAIASSRLWL
QIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQLWIMMYALLSVFSLLD
VILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQSPAILISGLGAMAAVLM
LVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNTITTIP
TWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDEMQRLNKAHLLKPYLTSRHQ
EINEWNRQQGSTESILNLRRMTNIGTFRAYLNEYLRNHPRIRKDMTLMVRQLAPGDNGLP
LEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQSPTGNDIRSLAGAFKQ