Protein Info for NOLOHH_23720 in Escherichia coli ECOR27

Name: nadD
Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 6 to 68 (63 residues), 46.5 bits, E=3.3e-16
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 7 to 212 (206 residues), 211.7 bits, E=1e-66
• PF01467: CTP_transf_like
  • amino acids 7 to 187 (181 residues), 108.8 bits, E=1.2e-35

Best Hits

Swiss-Prot: 100% identical to NADD_SHIF8: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to eco:b0639)

MetaCyc: 100% identical to nicotinate-nucleotide adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide adenylyltransferase. [EC: 2.7.7.18]

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD salvage pathway V (PNC V cycle) (3/5 steps found)
• NAD salvage (plants) (5/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)
• NAD de novo biosynthesis II (from tryptophan) (3/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Protein Sequence (213 amino acids)

>NOLOHH_23720 nicotinate-nucleotide adenylyltransferase (Escherichia coli ECOR27)
MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSVQRKHML
ELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAFIIGQDSLLTFPTWYEY
ETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHLQPAGKIYLAETPWFNIS
ATIIRERLQNGESCEDLLPEPVLTYINQQGLYR