Protein Info for NOLOHH_23620 in Escherichia coli ECOR27

Name: corC
Annotation: CNNM family magnesium/cobalt transport protein CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00571: CBS" amino acids 69 to 124 (56 residues), 35.6 bits, see alignment E=9.4e-13 amino acids 140 to 189 (50 residues), 27.4 bits, see alignment 3.4e-10 PF03471: CorC_HlyC" amino acids 206 to 281 (76 residues), 83.2 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 100% identical to CORC_ECO57: Magnesium and cobalt efflux protein CorC (corC) from Escherichia coli O157:H7

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 100% identity to eco:b0658)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>NOLOHH_23620 CNNM family magnesium/cobalt transport protein CorC (Escherichia coli ECOR27)
MSDDNSHSSDTISNKKGFFSLLLSQLFHGEPKNRDELLALIRDSGQNDLIDEDTRDMLEG
VMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAK
DLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVT
IEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIEDFNEAFGTHFSDEEVDTIG
GLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKIPDDSPQPKLDE