Protein Info for NOLOHH_23475 in Escherichia coli ECOR27

Name: potE
Annotation: putrescine-ornithine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 386 to 404 (19 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 1 to 432 (432 residues), 509.8 bits, see alignment E=7.4e-157 TIGR04299: putrescine-ornithine antiporter" amino acids 4 to 433 (430 residues), 850.7 bits, see alignment E=2.7e-260 PF13520: AA_permease_2" amino acids 10 to 404 (395 residues), 166.6 bits, see alignment E=9.3e-53 PF00324: AA_permease" amino acids 15 to 403 (389 residues), 71.1 bits, see alignment E=8.2e-24

Best Hits

Swiss-Prot: 100% identical to POTE_ECOL6: Putrescine transporter PotE (potE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03756, putrescine:ornithine antiporter (inferred from 100% identity to eco:b0692)

MetaCyc: 100% identical to putrescine transporter PotE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-69; TRANS-RXN0-211

Predicted SEED Role

"Putrescine/proton symporter, putrescine/ornithine antiporter PotE" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>NOLOHH_23475 putrescine-ornithine antiporter (Escherichia coli ECOR27)
MSQAKSNKMGVVQLTILTMVNMMGSGIIMLPTKLAEVGTISIISWLVTAVGSMALAWAFA
KCGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVAIAISAVGYGTELLGASLS
PVQIGLATIGVLWICTVANFGGARITGQISSITVWGVIIPVVGLCIIGWFWFSPTLYVDS
WNPHHAPFFSAVGSSIAMTLWAFLGLESACANTDVVENPERNVPIAVLGGTLGAAVIYIV
STNVIAGIVPNMELANSTAPFGLAFAQMFTPEVGKVIMALMVMSCCGSLLGWQFTIAQVF
KSSSDEGYFPKIFSRVTKVDAPVQGMLTIVIIQSGLALMTISPSLNSQFNVLVNLAVVTN
IIPYILSMAALVIIQKVANVPPSKAKVANFVAFVGAMYSFYALYSSGEEAMLYGSIVTFL
GWTLYGLVSPRFELKNKHG