Protein Info for NOLOHH_22065 in Escherichia coli ECOR27

Name: focA
Annotation: formate transporter FocA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 70 to 98 (29 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details TIGR04060: formate transporter FocA" amino acids 14 to 279 (266 residues), 426.5 bits, see alignment E=3.5e-132 PF01226: Form_Nir_trans" amino acids 15 to 276 (262 residues), 261.9 bits, see alignment E=2.6e-82 TIGR00790: formate/nitrite transporter" amino acids 26 to 280 (255 residues), 325.5 bits, see alignment E=2.1e-101

Best Hits

Swiss-Prot: 100% identical to FOCA_ECOLI: Probable formate transporter 1 (focA) from Escherichia coli (strain K12)

KEGG orthology group: K06212, formate transporter (inferred from 100% identity to eco:b0904)

MetaCyc: 100% identical to formate channel FocA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1; TRANS-RXN-381

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>NOLOHH_22065 formate transporter FocA (Escherichia coli ECOR27)
VKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG
TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG
NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW
MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE
NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH