Protein Info for NOLOHH_21405 in Escherichia coli ECOR27

Name: ycdX
Annotation: zinc-binding phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF02811: PHP" amino acids 5 to 77 (73 residues), 36.1 bits, see alignment E=4.4e-13

Best Hits

Swiss-Prot: 100% identical to YCDX_ECO5E: Probable phosphatase YcdX (ycdX) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K04477, putative hydrolase (inferred from 100% identity to ecd:ECDH10B_1106)

Predicted SEED Role

"Putative hydrolase YcdX (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>NOLOHH_21405 zinc-binding phosphatase (Escherichia coli ECOR27)
MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHFINMRIWP
RVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIAT
IASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSFLHSRKGSEDNCRAVAAAV
RDAGGWVALGSDSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFLESRGMAPIA
EFADL