Protein Info for NOLOHH_21340 in Escherichia coli ECOR27

Name: clsC
Annotation: cardiolipin synthase ClsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF13091: PLDc_2" amino acids 60 to 204 (145 residues), 39.6 bits, see alignment E=4.6e-14 amino acids 293 to 436 (144 residues), 95.4 bits, see alignment E=2.5e-31 PF00614: PLDc" amino acids 387 to 411 (25 residues), 22.6 bits, see alignment (E = 8e-09)

Best Hits

Swiss-Prot: 100% identical to CLSC_ECOLI: Cardiolipin synthase C (clsC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecc:c1310)

MetaCyc: 100% identical to cardiolipin synthase C (Escherichia coli K-12 substr. MG1655)
RXN0-7012 [EC: 2.7.8.41]

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>NOLOHH_21340 cardiolipin synthase ClsC (Escherichia coli ECOR27)
MMKKTPTSTKDSLPNKEMNDLPRLASAVLPLCSQHPGQCGLFPLEKSLDAFAARYRLAEM
AEHTLDVQYYIWQDDMSGRLLFSALLAAAKRGVRVRLLLDDNNTPGLDDILRLLDSHPRI
EVRLFNPFSFRLLRPLGYITDFSRLNRRMHNKSFTVDGVVTLVGGRNIGDAYFGAGEEPL
FSDLDVMAIGPVVEDVADDFARYWYCKSVSPLQQVLDVPEGEMADRIELPASWHNDAMTH
RYLRKMESSPFINHLVDGTLPLIWAKTRLLSDDPAKGEGKAKRHSLLPQRLFDIMGSPSE
RIDIISSYFVPTRAGVAQLLRMVRKGVKIAILTNSLAANDVAVVHAGYARWRKKLLRYGV
ELYELKPTREQSSTLHDRGITGNSGASLHAKTFSIDGKTVFIGSFNFDPRSTLLNTEMGF
VIESETLAQLIDKRFIQSQYDAAWQLRLDRWGRINWVDRHAKKEIILKKEPATSFWKRVM
VRLASILPVEWLL