Protein Info for NOLOHH_20745 in Escherichia coli ECOR27
Name: dsbB
Annotation: disulfide bond formation protein DsbB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to DSBB_SHIF8: Disulfide bond formation protein B (dsbB) from Shigella flexneri serotype 5b (strain 8401)
KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 99% identity to eco:b1185)MetaCyc: 99% identical to protein thiol:quinone oxidoreductase DsbB (Escherichia coli K-12 substr. MG1655)
RXN-19950 [EC: 1.8.5.9]
Predicted SEED Role
"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange
MetaCyc Pathways
- periplasmic disulfide bond formation (1/3 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.8.5.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (176 amino acids)
>NOLOHH_20745 disulfide bond formation protein DsbB (Escherichia coli ECOR27) MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWV PQVFVASGDCAERQWDFLGMEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR