Protein Info for NOLOHH_20635 in Escherichia coli ECOR27

Name: dauA
Annotation: C4-dicarboxylic acid transporter DauA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 163 to 190 (28 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details amino acids 399 to 429 (31 residues), see Phobius details TIGR00815: sulfate permease" amino acids 9 to 546 (538 residues), 501.1 bits, see alignment E=1.9e-154 PF00916: Sulfate_transp" amino acids 20 to 402 (383 residues), 260 bits, see alignment E=3.2e-81 PF01740: STAS" amino acids 443 to 543 (101 residues), 60.8 bits, see alignment E=9.8e-21

Best Hits

Swiss-Prot: 100% identical to DAUA_ECOLI: C4-dicarboxylic acid transporter DauA (dauA) from Escherichia coli (strain K12)

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to eco:b1206)

MetaCyc: 100% identical to aerobic C4-dicarboxylate transporter DauA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-122A; TRANS-RXN0-553

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>NOLOHH_20635 C4-dicarboxylic acid transporter DauA (Escherichia coli ECOR27)
MPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAG
IVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIE
YIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIG
IVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYVLADGSQGNG
IPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGTKHK
ANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLVLAP
LLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVLFDMVIAISV
GIVLASLLFMRRIARMTRLAPVAVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRI
VILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFF
PNRRAAMADL