Protein Info for NOLOHH_20590 in Escherichia coli ECOR27

Name: kdsA
Annotation: 3-deoxy-8-phosphooctulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00793: DAHP_synth_1" amino acids 10 to 274 (265 residues), 241 bits, see alignment E=5.7e-76 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 18 to 275 (258 residues), 393.1 bits, see alignment E=2.3e-122

Best Hits

Swiss-Prot: 100% identical to KDSA_SHIB3: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 100% identity to eco:b1215)

MetaCyc: 100% identical to 3-deoxy-D-manno-octulosonate 8-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>NOLOHH_20590 3-deoxy-8-phosphooctulonate synthase (Escherichia coli ECOR27)
MKQKVVSIGDINVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDK
ANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLAR
QTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDNLVVD
MLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGLFIEA
HPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKGFEELDTSK