Protein Info for NOLOHH_19370 in Escherichia coli ECOR27

Name: cybB
Annotation: cytochrome b561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 5 to 172 (168 residues), 87.4 bits, see alignment E=5.3e-29

Best Hits

Swiss-Prot: 99% identical to C561_SHIFL: Cytochrome b561 (cybB) from Shigella flexneri

KEGG orthology group: K12262, cytochrome b561 (inferred from 99% identity to eco:b1418)

MetaCyc: 99% identical to superoxide oxidase (Escherichia coli K-12 substr. MG1655)
RXN-20148 [EC: 1.10.3.17]

Predicted SEED Role

"Cytochrome b(561)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.10.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>NOLOHH_19370 cytochrome b561 (Escherichia coli ECOR27)
MENKYSRLQISIHWLVFLLVIAAYCAMEFRGFFPRSDRPLINMVHVSCGISILVLMVVRL
LLRLKYPTPPIIPKPKPMMTGLAHLGHLVIYLLFIALPVIGLVMMYNRGNPWFAFGLTMP
YASEANFERVDSLKSWHETLANLGYFVIGLHAAAALAHHYFWKDNTLLRMMPRKRS