Protein Info for NOLOHH_19195 in Escherichia coli ECOR27

Name: mcbR
Annotation: colanic acid/biofilm transcriptional regulator McbR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00392: GntR" amino acids 13 to 74 (62 residues), 42.6 bits, see alignment E=3.9e-15 PF07729: FCD" amino acids 84 to 209 (126 residues), 94.7 bits, see alignment E=5.9e-31

Best Hits

Swiss-Prot: 100% identical to MCBR_ECOLI: HTH-type transcriptional regulator McbR (mcbR) from Escherichia coli (strain K12)

KEGG orthology group: K13654, GntR family transcriptional regulator, colanic acid and biofilm gene transcriptional regulator (inferred from 100% identity to eco:b1450)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>NOLOHH_19195 colanic acid/biofilm transcriptional regulator McbR (Escherichia coli ECOR27)
MPGTGKMKHVSLTLQVENDLKHQLSIGALKPGARLITKNLAEQLGMSITPVREALLRLVS
VNALSVAPAQAFTVPEVGKRQLDEINRIRYELELMAVALAVENLTPQDLAELQELLEKLQ
QAQEKGDMEQIINVNRLFRLAIYHRSNMPILCEMIEQLWVRMGPGLHYLYEAINPAELRE
HIENYHLLLAALKAKDKEGCRHCLAEIMQQNIAILYQQYNR