Protein Info for NOLOHH_18845 in Escherichia coli ECOR27

Name: hipB
Annotation: type II toxin-antitoxin system antitoxin HipB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13744: HTH_37
  • amino acids 11 to 66 (56 residues), 29.2 bits, E=1.4e-10
• PF01381: HTH_3
  • amino acids 18 to 69 (52 residues), 55.1 bits, E=1.3e-18
• PF12844: HTH_19
  • amino acids 18 to 66 (49 residues), 30.4 bits, E=6.6e-11
• PF13443: HTH_26
  • amino acids 21 to 67 (47 residues), 24.8 bits, E=4.2e-09

Best Hits

Swiss-Prot: 98% identical to HIPB_ECOLI: Antitoxin HipB (hipB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b1508)

MetaCyc: 98% identical to antitoxin/DNA-binding transcriptional repressor HipB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"HipB protein"

Protein Sequence (88 amino acids)

>NOLOHH_18845 type II toxin-antitoxin system antitoxin HipB (Escherichia coli ECOR27)
MMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKI
LQSLELSMTLCDTKNASPESTEQQDLEW