Protein Info for NOLOHH_17635 in Escherichia coli ECOR27

Name: nlpC
Annotation: putative endopeptidase NlpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00877: NLPC_P60" amino acids 47 to 153 (107 residues), 118.8 bits, see alignment E=5.2e-39

Best Hits

Swiss-Prot: 99% identical to NLPC_ECOLI: Probable endopeptidase NlpC (nlpC) from Escherichia coli (strain K12)

KEGG orthology group: K13695, probable lipoprotein NlpC (inferred from 99% identity to ecl:EcolC_1923)

Predicted SEED Role

"Probable lipoprotein nlpC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>NOLOHH_17635 putative endopeptidase NlpC (Escherichia coli ECOR27)
MRFCLILITALFLAGCSHHKAPPPNARLSDSITVIAGLNDQLQSWHGTPYRYGGMTRRGV
DCSGFVVVTMRDRFDLQLPRETKEQASIGTQIDKDELLPGDLVFFKTGSGQNGLHVGIYD
TNNQFIHASTSKGVMRSSLDNVYWQKNFWQARRI