Protein Info for NOLOHH_17230 in Escherichia coli ECOR27

Name: cdgI
Annotation: putative diguanylate cyclase CdgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 293 to 318 (26 residues), see Phobius details PF17158: MASE4" amino acids 88 to 319 (232 residues), 178.6 bits, see alignment E=1.3e-56 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 326 to 488 (163 residues), 122.5 bits, see alignment E=7.4e-40 PF00990: GGDEF" amino acids 328 to 485 (158 residues), 152.2 bits, see alignment E=1.1e-48

Best Hits

Swiss-Prot: 100% identical to CDGI_ECOLI: Probable diguanylate cyclase CdgI (cdgI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1785)

Predicted SEED Role

"Inner membrane protein YeaI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>NOLOHH_17230 putative diguanylate cyclase CdgI (Escherichia coli ECOR27)
MIQSTRISMGLFFKYFLSLTKIDPGQNYISLPSIKSSTHIALLFMVSMGTQKLKAQSFFI
FSLLLTLILFCITTLYNENTNVKLIPQMNYLMVVVALFFLNAVIFLFMLMKYFTNKQILP
TLILSLAFLSGLIYLVETIVIIHKPINGSTLIQTKSNDVSIFYIFRQLSFICLTSLALFC
YGKDNILDNNKKKTGILLLALIPFLVFPLLAHNLSSYNADYSLYVVDYCPDNHTATWGIN
YTKILVCLWAFLLFFIIMRTRLASELWPLIALLCLASLCCNLLLLTLDEYNYTIWYISRG
IEVSSKLFVVSFLIYNIFQELQLSSKLAVHDVLTNIYNRRYFFNSVESLLSRPVVKDFCV
MLVDINQFKRINAQWGHRVGDKVLVSIVDIIQQSIRPDDILARLEGEVFGLLFTELNSAQ
AKIIAERMRKNVELLTGFSNRYDVPEQMTISIGTVFSTGDTRNISLVMTEADKALREAKS
EGGNKVIIHHI