Protein Info for NOLOHH_16805 in Escherichia coli ECOR27

Annotation: maltose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 262 (166 residues), 61.7 bits, see alignment E=4.1e-21

Best Hits

Swiss-Prot: 42% identical to MDXG_BACSU: Maltodextrin transport system permease protein MdxG (mdxG) from Bacillus subtilis (strain 168)

KEGG orthology group: K10110, maltose/maltodextrin transport system permease protein (inferred from 100% identity to eoj:ECO26_2697)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>NOLOHH_16805 maltose ABC transporter permease (Escherichia coli ECOR27)
MDKFLRKISTLLVYLFLICNSILVLGPVIWTIMASFKKGNNLFSSTFSGIEFTFDHYITL
FTDTPYMQWYLNTFILATANMLISLFVVTMTAYVFSRYRFRGKRNTLMSILVLQMFPAFL
SMTAIYILLSKANLIDTYTGLLLVYVTGSLPFMTWLVKGYFDAIPTSLDEAAKIDGAGHL
TIFIQIILPLAKPILVFVGLVSFTGPWMDFILPTLVLRSEDKMTLAIGIFSWIASNSAEN
YTLFAAGALLVAVPITLLFVFTQKHITTGLVSGAVKE