Protein Info for NOLOHH_16745 in Escherichia coli ECOR27

Name: znuA
Annotation: zinc ABC transporter substrate-binding protein ZnuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details PF01297: ZnuA" amino acids 46 to 324 (279 residues), 214.3 bits, see alignment E=1.1e-67

Best Hits

Swiss-Prot: 100% identical to ZNUA_ECOLI: High-affinity zinc uptake system protein ZnuA (znuA) from Escherichia coli (strain K12)

KEGG orthology group: K09815, zinc transport system substrate-binding protein (inferred from 100% identity to sfv:SFV_1860)

MetaCyc: 100% identical to Zn2+ ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>NOLOHH_16745 zinc ABC transporter substrate-binding protein ZnuA (Escherichia coli ECOR27)
MKCYNITLLIFITMIGRIMLHKKTLLFAALSAALWGGATQAADAAVVASLKPVGFIASAI
ADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPEAKQV
TIAQLEDVKPLLMKSIHGDDDDHDHAEKSDEDHHHGDFNMHLWLSPEIARATAVAIHGKL
VELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPL
GHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLG
TNIKLGKTSYSEFLSQLANQYASCLKGD