Protein Info for NOLOHH_15795 in Escherichia coli ECOR27

Name: wzzB
Annotation: LPS O-antigen chain length determinant protein WzzB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details PF02706: Wzz" amino acids 16 to 120 (105 residues), 65.6 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 92% identical to WZZB_SHIDY: Chain length determinant protein (wzzB) from Shigella dysenteriae

KEGG orthology group: K05789, chain length determinant protein (polysaccharide antigen chain regulator) (inferred from 98% identity to ecw:EcE24377A_2318)

Predicted SEED Role

"regulator of length of O-antigen component of lipopolysaccharide chains" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>NOLOHH_15795 LPS O-antigen chain length determinant protein WzzB (Escherichia coli ECOR27)
MRVENNNVSGQNHDPEQIDLIDLLVQLWRGKMTIIISVIVAIALAIGYLAVAKEKWTSTA
IVTQPDVGQIAGYTNAMNVIYGPAVPKVSDIQASLIGRYSTAFSALAETLDNQEEAEKLT
IEPTVKNQSLPLAVSYVGETPEGAQKQLAKYIQQVDDQVNEELEKDLKDNIALQMKNLQD
SLKTQEVVAQEQKDLRIRQIQEALQYANQAQVTKPQIQQTQDVTQDTMFLLGSEALESMI
KHEATRPLVFSPNYYQTRQNLLDIENLKVDDLDIHAYRYVMKPTLPIRRDSPKKAITLIL
AVLLGGMVGAGIVLGRNALRNYNAK