Protein Info for NOLOHH_15615 in Escherichia coli ECOR27

Name: dcd
Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 2 to 190 (189 residues), 224.6 bits, E=3.7e-71
• PF06559: DCD
  • amino acids 3 to 125 (123 residues), 34.2 bits, E=1.2e-12
• PF00692: dUTPase
  • amino acids 78 to 185 (108 residues), 34.4 bits, E=1.6e-12

Best Hits

Swiss-Prot: 100% identical to DCD_ECOHS: dCTP deaminase (dcd) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to eco:b2065)

MetaCyc: 100% identical to dCTP deaminase (Escherichia coli K-12 substr. MG1655)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Protein Sequence (193 amino acids)

>NOLOHH_15615 dCTP deaminase (Escherichia coli ECOR27)
MRLCDRDIEAWLDEGRLSINPRPPVERINGATVDVRLGNKFRTFRGHTAAFIDLSGPKDE
VSAALDRVMSDEIVLDEGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMV
HVTAHRIDPGWSGCIVLEFYNSGKLPLALRPGMLIGALSFEPLSGPAARPYNRREDAKYR
NQQGAVASRIDKD