Protein Info for NOLOHH_14995 in Escherichia coli ECOR27

Name: yeiP
Annotation: elongation factor P-like protein YeiP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR02178: elongation factor P-like protein YeiP" amino acids 3 to 189 (187 residues), 340.6 bits, see alignment E=1.5e-106 PF08207: EFP_N" amino acids 4 to 62 (59 residues), 56.5 bits, see alignment E=3.4e-19 PF01132: EFP" amino acids 72 to 124 (53 residues), 49.1 bits, see alignment E=6.6e-17 PF09285: Elong-fact-P_C" amino acids 133 to 188 (56 residues), 72.8 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 100% identical to EFPL_ECO7I: Elongation factor P-like protein (yeiP) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to eco:b2171)

Predicted SEED Role

"Translation elongation factor P-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>NOLOHH_14995 elongation factor P-like protein YeiP (Escherichia coli ECOR27)
MPRANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDD
IVDTVTLTRRYVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTW
DGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSPGEKIRIHI
EERRYMGRAD