Protein Info for NOLOHH_14465 in Escherichia coli ECOR27

Name: nuoB
Annotation: NADH-quinone oxidoreductase subunit NuoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 37 to 178 (142 residues), 234.6 bits, see alignment E=1.8e-74 PF01058: Oxidored_q6" amino acids 63 to 171 (109 residues), 93.9 bits, see alignment E=3.4e-31

Best Hits

Swiss-Prot: 100% identical to NUOB_SHIB3: NADH-quinone oxidoreductase subunit B (nuoB) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to eco:b2287)

MetaCyc: 100% identical to NADH:quinone oxidoreductase subunit B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>NOLOHH_14465 NADH-quinone oxidoreductase subunit NuoB (Escherichia coli ECOR27)
MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFG
LSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEP
KWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKER
RPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPDEI