Protein Info for NOLOHH_14260 in Escherichia coli ECOR27

Name: yfcA
Annotation: putative membrane transporter protein YfcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 7 to 38 (32 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details PF01925: TauE" amino acids 18 to 253 (236 residues), 166.2 bits, see alignment E=5.1e-53

Best Hits

Swiss-Prot: 100% identical to YFCA_ECO57: Probable membrane transporter protein YfcA (yfcA) from Escherichia coli O157:H7

KEGG orthology group: K07090, (no description) (inferred from 100% identity to eco:b2327)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>NOLOHH_14260 putative membrane transporter protein YfcA (Escherichia coli ECOR27)
METFNSLFMVSPLLLGVLFFVAMLAGFIDSIAGGGGLLTIPALMAAGMSPANALATNKLQ
ACGGSISATIYFIRRKVVSLSDQKLNIAMTFVGSMSGALLVQYVQADVLRQILPILVICI
GLYFLLMPKLGEEDRQRRMYGLPFALIAGGCVGFYDGFFGPAAGSFYALAFVTLCGFNLA
KATAHAKLLNATSNIGGLLLFILGGKVIWATGFVMLVGQFLGARMGSRLVLSKGQKLIRP
MIVIVSAVMSAKLLYDSHGQEILHWLGMN