Protein Info for NOLOHH_14025 in Escherichia coli ECOR27

Name: ypdF
Annotation: aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF01321: Creatinase_N" amino acids 4 to 125 (122 residues), 69.2 bits, see alignment E=5.2e-23 PF00557: Peptidase_M24" amino acids 134 to 342 (209 residues), 245.3 bits, see alignment E=5.5e-77

Best Hits

Swiss-Prot: 98% identical to YPDF_ECOLI: Aminopeptidase YpdF (ypdF) from Escherichia coli (strain K12)

KEGG orthology group: K08326, aminopeptidase [EC: 3.4.11.-] (inferred from 98% identity to eco:b2385)

MetaCyc: 98% identical to aminopeptidase YpdF (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"Aminopeptidase YpdF (MP-, MA-, MS-, AP-, NP- specific)" in subsystem Protein degradation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.-

Use Curated BLAST to search for 3.4.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>NOLOHH_14025 aminopeptidase (Escherichia coli ECOR27)
MTLLASLRDWLKAQQLDAVLLSSRQNKQPHLGISTGSGYVVISRESAHILVDSRYFVEVE
ARAQGYQLHLLDATNTLTTIVNQIIADEQLQTLGFEGQQVSWETAHRWKSELNAKLVSAT
PDVLRQIKTPEEVEIIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKAS
FDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNGEGVSAESH
PLFDVYQIVLQAQLAAISAIRPGVRCQQIDDAARRVITEAGFGDYFGHNTGHAIGIEVHE
DPRFSPRDTTTLQPGMLLTVEPGIYLPGQGGVRIEDVVLVTPQGAEVLYAMPKTVLLTGE
A