Protein Info for NOLOHH_14025 in Escherichia coli ECOR27

Name: ypdF
Annotation: aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01321: Creatinase_N
  • amino acids 4 to 125 (122 residues), 69.2 bits, E=5.2e-23
• PF00557: Peptidase_M24
  • amino acids 134 to 342 (209 residues), 245.3 bits, E=5.5e-77

Best Hits

Swiss-Prot: 98% identical to YPDF_ECOLI: Aminopeptidase YpdF (ypdF) from Escherichia coli (strain K12)

KEGG orthology group: K08326, aminopeptidase [EC: 3.4.11.-] (inferred from 98% identity to eco:b2385)

MetaCyc: 98% identical to aminopeptidase YpdF (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"Aminopeptidase YpdF (MP-, MA-, MS-, AP-, NP- specific)" in subsystem Protein degradation

MetaCyc Pathways

• γ-glutamyl cycle (5/6 steps found)
• glutathione degradation (DUG pathway) (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.-

Use Curated BLAST to search for 3.4.11.-

Protein Sequence (361 amino acids)

>NOLOHH_14025 aminopeptidase (Escherichia coli ECOR27)
MTLLASLRDWLKAQQLDAVLLSSRQNKQPHLGISTGSGYVVISRESAHILVDSRYFVEVE
ARAQGYQLHLLDATNTLTTIVNQIIADEQLQTLGFEGQQVSWETAHRWKSELNAKLVSAT
PDVLRQIKTPEEVEIIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKAS
FDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNGEGVSAESH
PLFDVYQIVLQAQLAAISAIRPGVRCQQIDDAARRVITEAGFGDYFGHNTGHAIGIEVHE
DPRFSPRDTTTLQPGMLLTVEPGIYLPGQGGVRIEDVVLVTPQGAEVLYAMPKTVLLTGE
A