Protein Info for NOLOHH_12490 in Escherichia coli ECOR27

Name: norV
Annotation: anaerobic nitric oxide reductase flavorubredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00753: Lactamase_B" amino acids 33 to 172 (140 residues), 53.1 bits, see alignment E=1e-17 PF19583: ODP" amino acids 35 to 228 (194 residues), 65.2 bits, see alignment E=2e-21 PF12706: Lactamase_B_2" amino acids 45 to 149 (105 residues), 29.9 bits, see alignment E=1.1e-10 PF00258: Flavodoxin_1" amino acids 256 to 389 (134 residues), 71.4 bits, see alignment E=2.3e-23 PF00301: Rubredoxin" amino acids 425 to 471 (47 residues), 75.2 bits, see alignment 8.4e-25

Best Hits

Swiss-Prot: 100% identical to NORV_ECO24: Anaerobic nitric oxide reductase flavorubredoxin (norV) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K12264, anaerobic nitric oxide reductase flavorubredoxin (inferred from 100% identity to eco:b2710)

MetaCyc: 100% identical to anaerobic nitric oxide reductase flavorubredoxin (Escherichia coli K-12 substr. MG1655)
1.18.98.-

Predicted SEED Role

"Anaerobic nitric oxide reductase flavorubredoxin" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>NOLOHH_12490 anaerobic nitric oxide reductase flavorubredoxin (Escherichia coli ECOR27)
MSIVVKNNIHWVGQRDWEVRDFHGTEYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFV
QNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGHHHHPEWN
FNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFND
EVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVE
LYLKWAADYQEDRITIFYDTMSNNTRMMADAIAQGIAETDPRVAVKIFNVARSDKNEILT
NVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGGAVDRLSTRL
QDAGFEMSLSLKAKWRPDQDALELCREHGREIARQWALAPLPQSTVNTVVKEETSATTTA
DLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFEELASEAK