Protein Info for NOLOHH_12350 in Escherichia coli ECOR27

Name: otnK
Annotation: 3-oxo-tetronate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF07005: SBD_N" amino acids 4 to 228 (225 residues), 255.5 bits, see alignment E=5.2e-80 PF17042: NBD_C" amino acids 253 to 411 (159 residues), 144.3 bits, see alignment E=5.2e-46

Best Hits

Swiss-Prot: 99% identical to OTNK_ECOLI: 3-oxo-tetronate kinase (otnK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ebr:ECB_02587)

Predicted SEED Role

"FIG00641944: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>NOLOHH_12350 3-oxo-tetronate kinase (Escherichia coli ECOR27)
MIKIGVIADDFTGATDIASFLVENGLPTVQINGVPTGKMPEAIDALVISLKTRSCPVVEA
TQQSLAALSWLQQQGCKQIYFKYCSTFDSTAKGNIGPVTDALMDALDTPFTVFSPALPVN
GRTVYQGYLFVMNQLLAESGMRHHPVNPMTDSYLPRLVEAQSTGRCGVVSAHVFEQGVDA
VRQELARLQQEGYRYAVLDALTEHHLEIQGEALRDAPLVTGGSGLAIGLARQWAQENGNQ
AREAGHPLAGRGVVLSGSCSQMTNRQVAHYRQIAPAREVDLARCLSTETLAAYAHELAEW
VLGQESVLAPLVFATASTDALAAIQQQYGAQKASQAVETLFSQLAARLAAEGVTRFIVAG
GETSGVVTQSLGIKGFHIGPTISPGVPWVNALDKPVSLALKSGNFGDEAFFSRAQREFLS