Protein Info for NOLOHH_11585 in Escherichia coli ECOR27

Name: mocA
Annotation: molybdenum cofactor cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR03310: molybdenum cofactor cytidylyltransferase" amino acids 5 to 184 (180 residues), 214.8 bits, see alignment E=5.2e-68 PF12804: NTP_transf_3" amino acids 6 to 143 (138 residues), 100.3 bits, see alignment E=6.8e-33

Best Hits

Swiss-Prot: 97% identical to MOCA_ECOLI: Molybdenum cofactor cytidylyltransferase (mocA) from Escherichia coli (strain K12)

KEGG orthology group: K07141, (no description) (inferred from 97% identity to eco:b2877)

MetaCyc: 97% identical to molybdenum cofactor cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6254 [EC: 2.7.7.76]

Predicted SEED Role

"CTP:molybdopterin cytidylyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>NOLOHH_11585 molybdenum cofactor cytidylyltransferase (Escherichia coli ECOR27)
MSAIDCIITAAGLSSRMGQWKMMLPWQQGTILDTSIKNALQFCSRIILVTGYRGNELHER
YANQSNITIIHNPDYAQGLLTSVKAAVPAVQTEHCFLTHGDMPTLTIDIFRKIWSLRNDG
AILPLHNGIPGHPILVSKPCLMQAIQRPNVTNMRQALLMGAHYSVEIENAEIILDIDTPD
DFITAQKRYTKI