Protein Info for NOLOHH_11545 in Escherichia coli ECOR27

Name: ygfS
Annotation: Putative electron transport protein YgfS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF12800: Fer4_4" amino acids 9 to 22 (14 residues), 12.6 bits, see alignment (E = 8.1e-05) amino acids 84 to 99 (16 residues), 22.5 bits, see alignment (E = 5e-08) PF13247: Fer4_11" amino acids 51 to 140 (90 residues), 49.4 bits, see alignment E=2.3e-16 PF12838: Fer4_7" amino acids 55 to 99 (45 residues), 29.2 bits, see alignment E=5.2e-10 PF00037: Fer4" amino acids 81 to 102 (22 residues), 30 bits, see alignment (E = 1.7e-10) PF13187: Fer4_9" amino acids 85 to 137 (53 residues), 34 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 100% identical to YGFS_ECOLI: Putative electron transport protein YgfS (ygfS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2886)

Predicted SEED Role

"Predicted oxidoreductase, Fe-S subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>NOLOHH_11545 Putative electron transport protein YgfS (Escherichia coli ECOR27)
MKSLIIVNPADCIGCRTCEVACVVAHPSEQELNADVFLPRLKVQRLDSISAPVMCHQCEN
APCVGACPVGALTMGEQVVQTNSARCIGCQSCVSACPFGMITIQSLPGDTRQQIVKCDLC
EQREEGPACVESCPTQALQLLTERELRRVRQQRIVASGENPL